PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV21729.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family WOX
Protein Properties Length: 298aa    MW: 33456.3 Da    PI: 9.1566
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV21729.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.63.9e-2271130357
                 --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                 +R+++t+eql++Leel+++ +r+psae++++++++l    +++ ++V++WFqN++a+e++
  KZV21729.1  71 SRWNPTPEQLRTLEELYRRgTRTPSAEQIQHITAQLrrygKIEGKNVFYWFQNHKARERQ 130
                 7*****************99**************************************97 PP

2Wus_type_Homeobox115.82e-3770132365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ++RW+PtpeQ++ Leely++G+rtP++e+iq+ita+L++yGkie+kNVfyWFQN+kaRerqk+
         KZV21729.1  70 SSRWNPTPEQLRTLEELYRRGTRTPSAEQIQHITAQLRRYGKIEGKNVFYWFQNHKARERQKR 132
                        79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003894.1E-568135IPR001356Homeobox domain
SuperFamilySSF466893.81E-1271136IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.8E-971130IPR009057Homeodomain-like
PfamPF000467.6E-2071130IPR001356Homeobox domain
CDDcd000863.93E-672132No hitNo description
PROSITE profilePS5007111.20876131IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048513Biological Processanimal organ development
GO:0099402Biological Processplant organ development
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MWMMGYNEGG DLTTLQDSFG GRKLRALVPR PAAANSPCLN LVHGADFLSL TIPTEQNKRD  60
TSSTQQVVVS SRWNPTPEQL RTLEELYRRG TRTPSAEQIQ HITAQLRRYG KIEGKNVFYW  120
FQNHKARERQ KRRRQLESHT DLEIPQKKES QGEETKNWAS PTKSSTNTEK TSRQGSAKVT  180
ETECKTDGWL QFDSDDSELQ QRRTLLQRNA TRQTMHLSSS SPTPDSSATI SAAKDGQDPP  240
PQPTAGVVRT LQLFPLGVVS NTGCVANDHH KDIEATDTPA ATATAMPFQF FEFLPLKN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007036797.13e-92WUSCHEL, putative isoform 2
SwissprotQ6X7K05e-55WOX1_ARATH; WUSCHEL-related homeobox 1
TrEMBLA0A061FW513e-92A0A061FW51_THECC; WUSCHEL, putative isoform 2
STRINGVIT_17s0000g02460.t011e-87(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46812342
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.16e-52WUSCHEL related homeobox 1